PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G267700.1
Common NamePOPTR_0006s28350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CO-like
Protein Properties Length: 349aa    MW: 37760.9 Da    PI: 6.3083
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G267700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.75.6e-09436436
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                        + C+ +++  ++lfC+ ++ +lC +C +++H  
  Potri.006G267700.1  4 KLCDSCKSATATLFCRADSAFLCVSCDSKIHAA 36
                        58*****************************54 PP

2zf-B_box27.56.5e-094691342
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                         ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  Potri.006G267700.1 46 VWVCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplaqrHERVPV 91
                        689*****************************66899999999986 PP

3CCT70.44.6e-24285328144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Potri.006G267700.1 285 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 328
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.808148IPR000315B-box-type zinc finger
SMARTSM003361.1E-14148IPR000315B-box-type zinc finger
PfamPF006431.3E-6443IPR000315B-box-type zinc finger
CDDcd000218.30E-10548No hitNo description
PROSITE profilePS5011910.8224491IPR000315B-box-type zinc finger
PfamPF006432.8E-74691IPR000315B-box-type zinc finger
CDDcd000211.55E-94791No hitNo description
SMARTSM003362.8E-104991IPR000315B-box-type zinc finger
PfamPF062035.2E-18285327IPR010402CCT domain
PROSITE profilePS5101716.787285327IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MASKLCDSCK SATATLFCRA DSAFLCVSCD SKIHAANKLA SRHARVWVCE VCEQAPAHVT  60
CKADAAALCV TCDRDIHSAN PLAQRHERVP VTPFFDSSSA AHGGGAAVNF LEYRYLDDVN  120
GGDDVSREEA EAESWLLPNP GGGNTKGVDS LDLNTGQYVF GAEMHPYLDL DRYVDQKVEV  180
EVQEQNSSGT TDGVVPVQSN KLGFQAPALV NDNCCFELDF SAGSKTFAGG YGYNSLSHSV  240
SSSSLDVGVV PDGSTLTDIS NPYSRSVSNG MESANQTVQL SAVDREARVL RYREKRKNRK  300
FEKTIRYASR KAYAETRPRI KGRFAKRTDS GVEVDRSSIY GFGVVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.128480.0bud| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1485090.0EF148509.1 Populus trichocarpa x Populus deltoides clone WS0131_O05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002309695.10.0CONSTANS-like protein 2
SwissprotQ940T91e-135COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLB9HB920.0B9HB92_POPTR; CONSTANS-like protein 2
STRINGPOPTR_0006s28350.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-125CONSTANS-like 4